Ephrin B1 (EFNB1) (NM_004429) Human Mass Spec Standard

CAT#: PH301886

EFNB1 MS Standard C13 and N15-labeled recombinant protein (NP_004420)

Product Images

Coomassie blue staining of purified EFNB1 protein (Cat# TP301886). The protein was produced from HEK293T cells transfected with EFNB1 cDNA clone (Cat# RC201886) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201886
• Predicted MW: 38 kDa
• Protein Sequence:
  Sequence Link

  >RC201886 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAG
  RPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNG
  SLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHE
  TVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAAL
  SLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004420
• RefSeq Size: 3344
• RefSeq ORF: 1038
• Synonyms: CFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2
• Locus ID: 1947
• UniProt ID: P98172
• Cytogenetics: Xq13.1
• Summary: 'The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Axon guidance