TDP1 (NM_001008744) Human Mass Spec Standard
CAT#: PH301888
TDP1 MS Standard C13 and N15-labeled recombinant protein (NP_001008744)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201888 |
Predicted MW | 68.4 kDa |
Protein Sequence |
>RC201888 protein sequence
Red=Cloning site Green=Tags(s) MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDS VLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKE EEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDW LVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIH TSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSET NVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESM LTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNA MPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFF AGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001008744 |
RefSeq Size | 3540 |
RefSeq ORF | 1824 |
Locus ID | 55775 |
UniProt ID | Q9NUW8, A0A024R6L5, B3KN41 |
Cytogenetics | 14q32.11 |
Summary | The protein encoded by this gene is involved in repairing stalled topoisomerase I-DNA complexes by catalyzing the hydrolysis of the phosphodiester bond between the tyrosine residue of topoisomerase I and the 3-prime phosphate of DNA. This protein may also remove glycolate from single-stranded DNA containing 3-prime phosphoglycolate, suggesting a role in repair of free-radical mediated DNA double-strand breaks. This gene is a member of the phospholipase D family and contains two PLD phosphodiesterase domains. Mutations in this gene are associated with the disease spinocerebellar ataxia with axonal neuropathy (SCAN1). [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413162 | TDP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423370 | TDP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413162 | Transient overexpression lysate of tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 1 |
USD 396.00 |
|
LY423370 | Transient overexpression lysate of tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 2 |
USD 396.00 |
|
PH314927 | TDP1 MS Standard C13 and N15-labeled recombinant protein (NP_060789) |
USD 2,055.00 |
|
TP301888 | Recombinant protein of human tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 2 |
USD 823.00 |
|
TP314927 | Recombinant protein of human tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review