CLN6 (NM_017882) Human Mass Spec Standard

CAT#: PH301904

CLN6 MS Standard C13 and N15-labeled recombinant protein (NP_060352)

Product Images

Coomassie blue staining of purified CLN6 protein (Cat# TP301904). The protein was produced from HEK293T cells transfected with CLN6 cDNA clone (Cat# RC201904) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201904
• Predicted MW: 35.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201904 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEATRRRQHLGATGGPGAQLGASFLQARHGSVSADEAARTAPFHLDLWFYFTLQNWVLDFGRPIAMLVFP
  LEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPRTLPRSITYVSIIIFIMGASIHLVGDSVNHRLLFS
  GYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILFMYFSGCFTASKAESLIPGPA
  LLLVAPSGLYYWYLVTEGQIFILFIFTFFAMLALVLHQKRKRLFLDSNGLFLFSSFALTLLLVALWVAWL
  WNDPVLRKKYPGVIYVPEPWAFYTLHVSSRH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060352
• RefSeq Size: 2258
• RefSeq ORF: 933
• Synonyms: CLN4A; HsT18960; nclf
• Locus ID: 54982
• UniProt ID: Q9NWW5, A0A024R601
• Cytogenetics: 15q23
• Summary: This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function. [provided by RefSeq, Oct 2008]
• Protein Families: Transmembrane