CLN6 (NM_017882) Human Recombinant Protein

CAT#: TP301904

Recombinant protein of human ceroid-lipofuscinosis, neuronal 6, late infantile, variant (CLN6)

Product Images

Coomassie blue staining of purified CLN6 protein (Cat# TP301904). The protein was produced from HEK293T cells transfected with CLN6 cDNA clone (Cat# RC201904) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201904 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEATRRRQHLGATGGPGAQLGASFLQARHGSVSADEAARTAPFHLDLWFYFTLQNWVLDFGRPIAMLVFP
  LEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPRTLPRSITYVSIIIFIMGASIHLVGDSVNHRLLFS
  GYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILFMYFSGCFTASKAESLIPGPA
  LLLVAPSGLYYWYLVTEGQIFILFIFTFFAMLALVLHQKRKRLFLDSNGLFLFSSFALTLLLVALWVAWL
  WNDPVLRKKYPGVIYVPEPWAFYTLHVSSRH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060352
• Locus ID: 54982
• UniProt ID: Q9NWW5, A0A024R601
• Cytogenetics: 15q23
• Refseq Size: 2258
• Refseq ORF: 933
• Synonyms: CLN4A; HsT18960; nclf
• Summary: This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function. [provided by RefSeq, Oct 2008]
• Protein Families: Transmembrane