HDAC11 (NM_024827) Human Mass Spec Standard

CAT#: PH301919

HDAC11 MS Standard C13 and N15-labeled recombinant protein (NP_079103)

Product Images

Coomassie blue staining of purified HDAC11 protein (Cat# TP301919). The protein was produced from HEK293T cells transfected with HDAC11 cDNA clone (Cat# RC201919) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201919
• Predicted MW: 39.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201919 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSMLVEAREASEED
  LLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGG
  FHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYP
  GDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVK
  RDELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079103
• RefSeq Size: 2918
• RefSeq ORF: 1041
• Synonyms: HD11
• Locus ID: 79885
• UniProt ID: Q96DB2
• Cytogenetics: 3p25.1
• Summary: This gene encodes a class IV histone deacetylase. The encoded protein is localized to the nucleus and may be involved in regulating the expression of interleukin 10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
• Protein Families: Druggable Genome, Transcription Factors