ATPase Inhibitory Factor 1 (ATPIF1) (NM_016311) Human Mass Spec Standard

CAT#: PH301920

ATPIF1 MS Standard C13 and N15-labeled recombinant protein (NP_057395)

Product Images

Coomassie blue staining of purified ATP5IF1 protein (Cat# TP301920). The protein was produced from HEK293T cells transfected with ATP5IF1 cDNA clone (Cat# RC201920) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201920
• Predicted MW: 12.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201920 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVTALAARTWLGVWGVRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAAL
  KKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057395
• RefSeq Size: 560
• RefSeq ORF: 318
• Synonyms: ATPI; ATPIF1; ATPIP; IP
• Locus ID: 93974
• UniProt ID: Q9UII2
• Cytogenetics: 1p35.3
• Summary: This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]