14 3 3 gamma (YWHAG) (NM_012479) Human Mass Spec Standard

CAT#: PH301925

YWHAG MS Standard C13 and N15-labeled recombinant protein (NP_036611)

Product Images

Coomassie blue staining of purified YWHAG protein (Cat# TP301925). The protein was produced from HEK293T cells transfected with YWHAG cDNA clone (Cat# RC201925) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201925
• Predicted MW: 28.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201925 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKT
  SADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATG
  EKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDT
  LNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036611
• RefSeq Size: 3779
• RefSeq ORF: 741
• Synonyms: 14-3-3GAMMA; EIEE56; PPP1R170
• Locus ID: 7532
• UniProt ID: P61981
• Cytogenetics: 7q11.23
• Summary: 'This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis