14 3 3 gamma (YWHAG) (NM_012479) Human Recombinant Protein

CAT#: TP301925

Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide (YWHAG)

Product Images

Coomassie blue staining of purified YWHAG protein (Cat# TP301925). The protein was produced from HEK293T cells transfected with YWHAG cDNA clone (Cat# RC201925) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201925 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKT
  SADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATG
  EKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDT
  LNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036611
• Locus ID: 7532
• UniProt ID: P61981
• Cytogenetics: 7q11.23
• Refseq Size: 3779
• Refseq ORF: 741
• Synonyms: 14-3-3GAMMA; DEE56; EIEE56; PPP1R170
• Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis