PIM2 (NM_006875) Human Mass Spec Standard

CAT#: PH301933

PIM2 MS Standard C13 and N15-labeled recombinant protein (NP_006866)

Product Images

Coomassie blue staining of purified PIM2 protein (Cat# TP301933). The protein was produced from HEK293T cells transfected with PIM2 cDNA clone (Cat# RC201933) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201933
• Predicted MW: 34.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201933 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLG
  WSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPS
  RCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS
  RHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEI
  LLDPWMQTPAEDVPLNPSKGGPAPLAWSLLP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006866
• RefSeq Size: 2234
• RefSeq ORF: 933
• Locus ID: 11040
• UniProt ID: Q9P1W9, A0A024QYW7
• Cytogenetics: Xp11.23
• Summary: This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival. [provided by RefSeq, Nov 2009]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Acute myeloid leukemia