ZNRD2 (NM_006396) Human Mass Spec Standard

CAT#: PH301946

SSSCA1 MS Standard C13 and N15-labeled recombinant protein (NP_006387)

Product Images

Coomassie blue staining of purified ZNRD2 protein (Cat# TP301946). The protein was produced from HEK293T cells transfected with ZNRD2 cDNA clone (Cat# RC201946) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201946
• Predicted MW: 21.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201946 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYC
  VACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEGAAAGLKAAQGPPA
  PAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006387
• RefSeq Size: 661
• RefSeq ORF: 597
• Synonyms: p27; SSSCA1
• Locus ID: 10534
• UniProt ID: O60232
• Cytogenetics: 11q13.1
• Summary: This antigen is recognized by a subset of anti-centromere antibodies from patients with scleroderma and/or Sjogren's syndrome. Subcellular localization has not yet been established. [provided by RefSeq, Jul 2008]