RALB (NM_002881) Human Mass Spec Standard

CAT#: PH301982

RALB MS Standard C13 and N15-labeled recombinant protein (NP_002872)

Product Images

Coomassie blue staining of purified RALB protein (Cat# TP301982). The protein was produced from HEK293T cells transfected with RALB cDNA clone (Cat# RC201982) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201982
• Predicted MW: 23.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201982 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA
  GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPV
  EEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002872
• RefSeq Size: 2275
• RefSeq ORF: 618
• Synonyms: GTP binding protein; GTP binding protein); RAS-like protein B; v-ral simian leukemia viral oncogene homolog B; v-ral simian leukemia viral oncogene homolog B (ras related
• Locus ID: 5899
• UniProt ID: P11234, A0A024RAG3
• Cytogenetics: 2q14.2
• Summary: 'This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Pancreatic cancer, Pathways in cancer