NEUROD1 (NM_002500) Human Mass Spec Standard

CAT#: PH301987

NEUROD1 MS Standard C13 and N15-labeled recombinant protein (NP_002491)

Product Images

Coomassie blue staining of purified NEUROD1 protein (Cat# TP301987). The protein was produced from HEK293T cells transfected with NEUROD1 cDNA clone (Cat# RC201987) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201987
• Predicted MW: 39.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201987 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGGEEEDEDEDLEEEE
  EEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKI
  ETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTA
  SASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSIN
  GNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL
  NAIFHD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002491
• RefSeq Size: 3002
• RefSeq ORF: 1068
• Synonyms: BETA2; BHF-1; bHLHa3; MODY6; NEUROD
• Locus ID: 4760
• UniProt ID: Q13562
• Cytogenetics: 2q31.3
• Summary: 'This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus. [provided by RefSeq, Jul 2008]'
• Protein Families: Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young