EPCAM (NM_002354) Human Mass Spec Standard
CAT#: PH301989
EPCAM MS Standard C13 and N15-labeled recombinant protein (NP_002345)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201989 |
Predicted MW | 34.9 kDa |
Protein Sequence |
>RC201989 representing NM_002354
Red=Cloning site Green=Tags(s) MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVR TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA TRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002345 |
RefSeq Size | 1528 |
RefSeq ORF | 942 |
Synonyms | DIAR5; EGP-2; EGP40; EGP314; ESA; HNPCC8; KS1/4; KSA; M4S1; MIC18; MK-1; TACSTD1; TROP1 |
Locus ID | 4072 |
UniProt ID | P16422 |
Cytogenetics | 2p21 |
Summary | 'This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008]' |
Protein Families | ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400847 | EPCAM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400847 | Transient overexpression lysate of epithelial cell adhesion molecule (EPCAM) |
USD 325.00 |
|
TP301989 | Recombinant protein of human epithelial cell adhesion molecule (EPCAM) |
USD 823.00 |
|
TP710374 | Purified recombinant protein of Human epithelial cell adhesion molecule (EPCAM), esidues 24-265aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
|
TP720296 | Recombinant protein of human epithelial cell adhesion molecule (EPCAM) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review