BMX (NM_203281) Human Mass Spec Standard
CAT#: PH302002
BMX MS Standard C13 and N15-labeled recombinant protein (NP_975010)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202002 |
Predicted MW | 78 kDa |
Protein Sequence |
>RC202002 protein sequence
Red=Cloning site Green=Tags(s) MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEE QTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKYHSGFFVDGKFLCCQQSCKAA PGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSS TSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP ESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYH VHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTE YISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRY VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHR LYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_975010 |
RefSeq Size | 2592 |
RefSeq ORF | 2025 |
Synonyms | ETK; PSCTK2; PSCTK3 |
Locus ID | 660 |
UniProt ID | P51813 |
Cytogenetics | Xp22.2 |
Summary | 'This gene encodes a non-receptor tyrosine kinase belonging to the Tec kinase family. The protein contains a PH-like domain, which mediates membrane targeting by binding to phosphatidylinositol 3,4,5-triphosphate (PIP3), and a SH2 domain that binds to tyrosine-phosphorylated proteins and functions in signal transduction. The protein is implicated in several signal transduction pathways including the Stat pathway, and regulates differentiation and tumorigenicity of several types of cancer cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2016]' |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400648 | BMX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404365 | BMX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430904 | BMX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY400648 | Transient overexpression lysate of BMX non-receptor tyrosine kinase (BMX), transcript variant 2 |
USD 396.00 |
|
LY404365 | Transient overexpression lysate of BMX non-receptor tyrosine kinase (BMX), transcript variant 1 |
USD 396.00 |
|
LY430904 | Transient overexpression lysate of BMX non-receptor tyrosine kinase (BMX), transcript variant 1 |
USD 605.00 |
|
PH321915 | BMX MS Standard C13 and N15-labeled recombinant protein (NP_001712) |
USD 2,055.00 |
|
TP302002 | Recombinant protein of human BMX non-receptor tyrosine kinase (BMX), transcript variant 1 |
USD 867.00 |
|
TP321915 | Recombinant protein of human BMX non-receptor tyrosine kinase (BMX), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review