FE65 (APBB1) (NM_001164) Human Mass Spec Standard
CAT#: PH302003
APBB1 MS Standard C13 and N15-labeled recombinant protein (NP_001155)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202003 |
Predicted MW | 77 kDa |
Protein Sequence |
>RC202003 protein sequence
Red=Cloning site Green=Tags(s) MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWL KEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIIS TQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPREHSKSASLLF GMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQW EPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEP LPQEEEKLPPRNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRDFAYVARDKLTQMLKCHVFRCEAPAKNIA TSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVI NGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASF CCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKP KRLGAHTP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001155 |
RefSeq Size | 2699 |
RefSeq ORF | 825 |
Synonyms | FE65; MGC:9072; RIR |
Locus ID | 322 |
UniProt ID | O00213 |
Cytogenetics | 11p15.4 |
Summary | 'The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer's disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene product's nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimer's disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Mar 2012]' |
Protein Families | Transcription Factors |
Protein Pathways | Alzheimer's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400467 | APBB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC407894 | APBB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400467 | Transient overexpression lysate of amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) (APBB1), transcript variant 1 |
USD 325.00 |
|
LY407894 | Transient overexpression lysate of amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) (APBB1), transcript variant 2 |
USD 325.00 |
|
PH315214 | APBB1 MS Standard C13 and N15-labeled recombinant protein (NP_663722) |
USD 2,055.00 |
|
TP302003 | Recombinant protein of human amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) (APBB1), transcript variant 1 |
USD 823.00 |
|
TP315214 | Recombinant protein of human amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) (APBB1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review