TSPAN6 (NM_003270) Human Mass Spec Standard

CAT#: PH302014

TSPAN6 MS Standard C13 and N15-labeled recombinant protein (NP_003261)

Product Images

Coomassie blue staining of purified TSPAN6 protein (Cat# TP302014). The protein was produced from HEK293T cells transfected with TSPAN6 cDNA clone (Cat# RC202014) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202014
• Predicted MW: 27.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202014 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTV
  IILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYR
  SHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMG
  VVAGISFGVACFQLIGIFLAYCLSRAITNNQYEIV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003261
• RefSeq Size: 3833
• RefSeq ORF: 735
• Synonyms: T245; TM4SF6; TSPAN-6
• Locus ID: 7105
• UniProt ID: O43657
• Cytogenetics: Xq22.1
• Summary: 'The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The protein encoded by this gene is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2 protein. It functions as a negative regulator of retinoic acid-inducible gene I-like receptor-mediated immune signaling via its interaction with the mitochondrial antiviral signaling-centered signalosome. This gene uses alternative polyadenylation sites, and multiple transcript variants result from alternative splicing. [provided by RefSeq, Jul 2013]'
• Protein Families: Transmembrane