LYPLA2 (NM_007260) Human Mass Spec Standard

CAT#: PH302021

LYPLA2 MS Standard C13 and N15-labeled recombinant protein (NP_009191)

Product Images

Coomassie blue staining of purified LYPLA2 protein (Cat# TP302021). The protein was produced from HEK293T cells transfected with LYPLA2 cDNA clone (Cat# RC202021) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202021
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202021 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM
  VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLA
  GIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMH
  SSCPQEMAAVKEFLEKLLPPV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009191
• RefSeq Size: 1648
• RefSeq ORF: 693
• Synonyms: APT-2; APT2; DJ886K2.4
• Locus ID: 11313
• UniProt ID: O95372, A0A140VJC9
• Cytogenetics: 1p36.11
• Summary: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq, Jul 2008]
• Protein Pathways: Glycerophospholipid metabolism