LYPLA2 (NM_007260) Human Recombinant Protein

CAT#: TP302021

Recombinant protein of human lysophospholipase II (LYPLA2)

Product Images

Coomassie blue staining of purified LYPLA2 protein (Cat# TP302021). The protein was produced from HEK293T cells transfected with LYPLA2 cDNA clone (Cat# RC202021) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202021 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM
  VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLA
  GIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMH
  SSCPQEMAAVKEFLEKLLPPV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_009191
• Locus ID: 11313
• UniProt ID: O95372, A0A140VJC9
• Cytogenetics: 1p36.11
• Refseq Size: 1648
• Refseq ORF: 693
• Synonyms: APT-2; APT2; DJ886K2.4
• Summary: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq, Jul 2008]
• Protein Pathways: Glycerophospholipid metabolism