RAIDD (CRADD) (NM_003805) Human Mass Spec Standard

CAT#: PH302050

CRADD MS Standard C13 and N15-labeled recombinant protein (NP_003796)

Product Images

Coomassie blue staining of purified CRADD protein (Cat# TP302050). The protein was produced from HEK293T cells transfected with CRADD cDNA clone (Cat# RC202050) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202050
• Predicted MW: 22.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202050 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFD
  TFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGL
  SQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003796
• RefSeq Size: 1201
• RefSeq ORF: 597
• Synonyms: MRT34; RAIDD
• Locus ID: 8738
• UniProt ID: P78560, Q53XL1
• Cytogenetics: 12q22
• Summary: This gene encodes a protein containing a death domain (DD) motif. This protein recruits caspase 2/ICH1 to the cell death signal transduction complex, which includes tumor necrosis factor receptor 1 (TNFR1A) and RIPK1/RIP kinase, and acts in promoting apoptosis. A mutation in this gene was associated with cognitive disability. A related pseudogene is found on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
• Protein Families: Druggable Genome