MSX2 (NM_002449) Human Mass Spec Standard

CAT#: PH302056

MSX2 MS Standard C13 and N15-labeled recombinant protein (NP_002440)

Product Images

Coomassie blue staining of purified MSX2 protein (Cat# TP302056). The protein was produced from HEK293T cells transfected with MSX2 cDNA clone (Cat# RC202056) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202056
• Predicted MW: 28.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202056 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKEASPLPAESA
  SAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPGRYSPPPRHTSPTTCTLRKHK
  TNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKM
  AAKPMLPSSFSLPFPISSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002440
• RefSeq Size: 2224
• RefSeq ORF: 801
• Synonyms: CRS2; FPP; HOX8; MSH; PFM; PFM1
• Locus ID: 4488
• UniProt ID: P35548
• Cytogenetics: 5q35.2
• Summary: 'This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transcription Factors