STOM (NM_004099) Human Mass Spec Standard

CAT#: PH302060

STOM MS Standard C13 and N15-labeled recombinant protein (NP_004090)

Product Images

Coomassie blue staining of purified STOM protein (Cat# TP302060). The protein was produced from HEK293T cells transfected with STOM cDNA clone (Cat# RC202060) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202060
• Predicted MW: 31.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202060 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEKRHTRDSEAQRLPDSFKDSPSKGLGPCGWILVAFSFLFTVITFPISIWMCIKIIKEYERAIIFRLGR
  ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNAD
  SATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVERVEIKDVKLPVQLQRAMAAE
  AEASREARAKVIAAEGEMNASRALKEASMVITEYPAALQLRYLQTLTTIAAEKNSTIVFPLPIDMLQGII
  GAKHSHLG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004090
• RefSeq Size: 3198
• RefSeq ORF: 864
• Synonyms: BND7; EPB7; EPB72
• Locus ID: 2040
• UniProt ID: P27105, A0A024R882
• Cytogenetics: 9q33.2
• Summary: 'This gene encodes a member of a highly conserved family of integral membrane proteins. The encoded protein localizes to the cell membrane of red blood cells and other cell types, where it may regulate ion channels and transporters. Loss of localization of the encoded protein is associated with hereditary stomatocytosis, a form of hemolytic anemia. There is a pseudogene for this gene on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]'
• Protein Families: Transmembrane