UCHL3 (NM_006002) Human Mass Spec Standard

CAT#: PH302065

UCHL3 MS Standard C13 and N15-labeled recombinant protein (NP_005993)

Product Images

Coomassie blue staining of purified UCHL3 protein (Cat# TP302065). The protein was produced from HEK293T cells transfected with UCHL3 cDNA clone (Cat# RC202065) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202065
• Predicted MW: 26.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202065 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEE
  EKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLEN
  YDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCK
  KFMERDPDELRFNAIALSAA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005993
• RefSeq Size: 972
• RefSeq ORF: 690
• Synonyms: UCH-L3
• Locus ID: 7347
• UniProt ID: P15374, A0A140VJZ4
• Cytogenetics: 13q22.2
• Summary: The protein encoded by this gene is a member of the deubiquitinating enzyme family. Members of this family are proteases that catalyze the removal of ubiquitin from polypeptides and are divided into five classes, depending on the mechanism of catalysis. This protein may hydrolyze the ubiquitinyl-N-epsilon amide bond of ubiquitinated proteins to regenerate ubiquitin for another catalytic cycle. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]
• Protein Families: Druggable Genome, Protease