Noxa (PMAIP1) (NM_021127) Human Mass Spec Standard

CAT#: PH302071

PMAIP1 MS Standard C13 and N15-labeled recombinant protein (NP_066950)

Product Images

Coomassie blue staining of purified PMAIP1 protein (Cat# TP302071). The protein was produced from HEK293T cells transfected with PMAIP1 cDNA clone (Cat# RC202071) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202071
• Predicted MW: 5.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202071 representing NM_021127
  Red=Cloning site Green=Tags(s)
  
  MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066950
• RefSeq Size: 1885
• RefSeq ORF: 162
• Synonyms: APR; NOXA
• Locus ID: 5366
• UniProt ID: Q13794, A0A0S2Z490
• Cytogenetics: 18q21.32
• Summary: 'This gene belongs to a pro-apoptotic subfamily within the BCL-2 protein family, referred to as the BCL-2 homology domain 3 (BH3)-only subfamily, which determine whether a cell commits to apoptosis. In response to death-inducing stimuli, BH3-only members inhibit the anti-apoptotic BCL-2 family members, which under steady-state conditions keep the multi-BH domain proteins BAX and BAK, in an inactive state. [provided by RefSeq, Aug 2020]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: p53 signaling pathway