MLC1SA (MYL6B) (NM_002475) Human Mass Spec Standard

CAT#: PH302076

MYL6B MS Standard C13 and N15-labeled recombinant protein (NP_002466)

Product Images

Coomassie blue staining of purified MYL6B protein (Cat# TP302076). The protein was produced from HEK293T cells transfected with MYL6B cDNA clone (Cat# RC202076) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202076
• Predicted MW: 22.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202076 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFK
  EAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQ
  GTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002466
• RefSeq Size: 1008
• RefSeq ORF: 624
• Synonyms: MLC1SA
• Locus ID: 140465
• UniProt ID: P14649, A0A024RB31
• Cytogenetics: 12q13.2
• Summary: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010]
• Protein Pathways: Vascular smooth muscle contraction