FRA1 (FOSL1) (NM_005438) Human Mass Spec Standard

CAT#: PH302104

FOSL1 MS Standard C13 and N15-labeled recombinant protein (NP_005429)

Product Images

Coomassie blue staining of purified FOSL1 protein (Cat# TP302104). The protein was produced from HEK293T cells transfected with FOSL1 cDNA clone (Cat# RC202104) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202104
• Predicted MW: 29.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202104 representing NM_005438
  Red=Cloning site Green=Tags(s)
  
  MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTY
  PQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKL
  EDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVL
  EPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005429
• RefSeq Size: 1759
• RefSeq ORF: 813
• Synonyms: FRA; fra-1; FRA1
• Locus ID: 8061
• UniProt ID: P15407, A0A0S2Z595
• Cytogenetics: 11q13.1
• Summary: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Wnt signaling pathway