BPGM (NM_199186) Human Mass Spec Standard
CAT#: PH302105
BPGM MS Standard C13 and N15-labeled recombinant protein (NP_954655)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202105 |
| Predicted MW | 30 kDa |
| Protein Sequence |
>RC202105 protein sequence
Red=Cloning site Green=Tags(s) MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLI LEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDR RYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINI TLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_954655 |
| RefSeq Size | 2121 |
| RefSeq ORF | 777 |
| Synonyms | DPGM; ECYT8 |
| Locus ID | 669 |
| UniProt ID | P07738, A0A024R782 |
| Cytogenetics | 7q33 |
| Summary | '2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds to and decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPG synthesis via its synthetase activity, and 2,3-DPG degradation via its phosphatase activity. The enzyme also has phosphoglycerate phosphomutase activity. Deficiency of this enzyme increases the affinity of cells for oxygen. Mutations in this gene result in hemolytic anemia. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2009]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404682 | BPGM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC419780 | BPGM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430797 | BPGM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY404682 | Transient overexpression lysate of 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 2 |
USD 436.00 |
|
| LY419780 | Transient overexpression lysate of 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1 |
USD 436.00 |
|
| LY430797 | Transient overexpression lysate of 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 2 |
USD 396.00 |
|
| PH323838 | BPGM MS Standard C13 and N15-labeled recombinant protein (NP_001715) |
USD 2,055.00 |
|
| TP302105 | Recombinant protein of human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 2 |
USD 823.00 |
|
| TP323838 | Recombinant protein of human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1 |
USD 748.00 |
|
| TP720896 | Purified recombinant protein of Human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China