PDCD5 (NM_004708) Human Mass Spec Standard

CAT#: PH302119

PDCD5 MS Standard C13 and N15-labeled recombinant protein (NP_004699)

Product Images

Coomassie blue staining of purified PDCD5 protein (Cat# TP302119). The protein was produced from HEK293T cells transfected with PDCD5 cDNA clone (Cat# RC202119) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202119
• Predicted MW: 14.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202119 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAV
  ENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004699
• RefSeq Size: 604
• RefSeq ORF: 375
• Synonyms: TFAR19
• Locus ID: 9141
• UniProt ID: O14737
• Cytogenetics: 19q13.11
• Summary: This gene encodes a protein that is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. The encoded protein may be an important regulator of K(lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. Pseudogenes have been identified on chromosomes 5 and 12 [provided by RefSeq, Dec 2010]