Membrin (GOSR2) (NM_004287) Human Mass Spec Standard

CAT#: PH302175

GOSR2 MS Standard C13 and N15-labeled recombinant protein (NP_004278)

Product Images

Coomassie blue staining of purified GOSR2 protein (Cat# TP302175). The protein was produced from HEK293T cells transfected with GOSR2 cDNA clone (Cat# RC202175) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202175
• Predicted MW: 24.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202175 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRV
  DQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDL
  ILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQY
  LT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004278
• RefSeq Size: 3319
• RefSeq ORF: 636
• Synonyms: Bos1; EPM6; GS27
• Locus ID: 9570
• UniProt ID: O14653
• Cytogenetics: 17q21.32
• Summary: This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport