MCP1 (CCL2) (NM_002982) Human Mass Spec Standard
CAT#: PH302180
CCL2 MS Standard C13 and N15-labeled recombinant protein (NP_002973)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202180 |
Predicted MW | 11 kDa |
Protein Sequence |
>RC202180 protein sequence
Red=Cloning site Green=Tags(s) MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIV AKEICADPKQKWVQDSMDHLDKQTQTPKT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002973 |
RefSeq Size | 760 |
RefSeq ORF | 297 |
Synonyms | GDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF |
Locus ID | 6347 |
UniProt ID | P13500 |
Cytogenetics | 17q12 |
Summary | 'This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and basophils but not for neutrophils or eosinophils. It has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis and atherosclerosis. It binds to chemokine receptors CCR2 and CCR4. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 (SARS‐CoV‐2) infection. [provided by RefSeq, Aug 2020]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401046 | CCL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401046 | Transient overexpression lysate of chemokine (C-C motif) ligand 2 (CCL2) |
USD 325.00 |
|
TP302180 | Recombinant protein of human chemokine (C-C motif) ligand 2 (CCL2) |
USD 823.00 |
|
TP723280 | Purified recombinant protein of Human chemokine (C-C motif) ligand 2 (CCL2). |
USD 240.00 |
|
TP723718 | Purified recombinant protein of Human chemokine (C-C motif) ligand 2 (CCL2 / MCP-1) |
USD 205.00 |
{0} Product Review(s)
Be the first one to submit a review