Cystathionase (CTH) (NM_001902) Human Mass Spec Standard
CAT#: PH302195
CTH MS Standard C13 and N15-labeled recombinant protein (NP_001893)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202195 |
Predicted MW | 44.5 kDa |
Protein Sequence |
>RC202195 protein sequence
Red=Cloning site Green=Tags(s) MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA TKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001893 |
RefSeq Size | 2140 |
RefSeq ORF | 1215 |
Synonyms | MGC9471 |
Locus ID | 1491 |
UniProt ID | P32929 |
Cytogenetics | 1p31.1 |
Summary | 'This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq, Jun 2010]' |
Protein Pathways | Cysteine and methionine metabolism, Glycine, serine and threonine metabolism, Metabolic pathways, Nitrogen metabolism, Selenoamino acid metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419669 | CTH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC434190 | CTH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419669 | Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1 |
USD 325.00 |
|
LY434190 | Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3 |
USD 325.00 |
|
TP302195 | Recombinant protein of human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1 |
USD 823.00 |
|
TP720917 | Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review