Cystathionase (CTH) (NM_001902) Human Recombinant Protein

CAT#: TP720917

Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1


  View other "CTH" proteins (6)

USD 300.00

2 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
GHMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCY
Tag Tag Free
Predicted MW 44.7 kDa
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as a 0.2 µM filtered solution of PBS, pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 3 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_001893
Locus ID 1491
UniProt ID P32929
Cytogenetics 1p31.1
Refseq Size 2140
Refseq ORF 1215
Synonyms MGC9471
Summary 'This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq, Jun 2010]'
Protein Pathways Cysteine and methionine metabolism, Glycine, serine and threonine metabolism, Metabolic pathways, Nitrogen metabolism, Selenoamino acid metabolism

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.