Cystathionase (CTH) (NM_001902) Human Recombinant Protein
CAT#: TP720917
Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
GHMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCY
|
Tag | Tag Free |
Predicted MW | 44.7 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of PBS, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001893 |
Locus ID | 1491 |
UniProt ID | P32929 |
Cytogenetics | 1p31.1 |
Refseq Size | 2140 |
Refseq ORF | 1215 |
Synonyms | MGC9471 |
Summary | 'This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq, Jun 2010]' |
Protein Pathways | Cysteine and methionine metabolism, Glycine, serine and threonine metabolism, Metabolic pathways, Nitrogen metabolism, Selenoamino acid metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419669 | CTH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC434190 | CTH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419669 | Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1 |
USD 325.00 |
|
LY434190 | Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3 |
USD 325.00 |
|
PH302195 | CTH MS Standard C13 and N15-labeled recombinant protein (NP_001893) |
USD 2,055.00 |
|
TP302195 | Recombinant protein of human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review