RAB38 (NM_022337) Human Mass Spec Standard

CAT#: PH302196

RAB38 MS Standard C13 and N15-labeled recombinant protein (NP_071732)

Product Images

Coomassie blue staining of purified RAB38 protein (Cat# TP302196). The protein was produced from HEK293T cells transfected with RAB38 cDNA clone (Cat# RC202196) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202196
• Predicted MW: 23.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202196 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQE
  RFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNG
  LKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAK
  S
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071732
• RefSeq Size: 1479
• RefSeq ORF: 633
• Synonyms: NY-MEL-1; rrGTPbp
• Locus ID: 23682
• UniProt ID: P57729, A0A024R191
• Cytogenetics: 11q14.2
• Protein Families: Druggable Genome