STYX (NM_145251) Human Mass Spec Standard

CAT#: PH302205

STYX MS Standard C13 and N15-labeled recombinant protein (NP_660294)

Product Images

Coomassie blue staining of purified STYX protein (Cat# TP302205). The protein was produced from HEK293T cells transfected with STYX cDNA clone (Cat# RC202205) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202205
• Predicted MW: 25.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202205 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEAN
  FIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFG
  MKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLSVHSGTTGSLKRTHEEED
  DFGTMQVATAQNG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660294
• RefSeq Size: 4879
• RefSeq ORF: 669
• Synonyms: FLJ42934
• Locus ID: 6815
• UniProt ID: Q8WUJ0, A0A024R641
• Cytogenetics: 14q22.1
• Summary: 'The protein encoded by this gene is a pseudophosphatase, able to bind potential substrates but lacking an active catalytic loop. The encoded protein may be involved in spermiogenesis. Two transcript variants encoding the same protein have been found for these genes. [provided by RefSeq, Oct 2011]'
• Protein Families: Druggable Genome, Phosphatase