CD164 (NM_006016) Human Mass Spec Standard
CAT#: PH302234
CD164 MS Standard C13 and N15-labeled recombinant protein (NP_006007)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202234 |
Predicted MW | 20.9 kDa |
Protein Sequence |
>RC202234 protein sequence
Red=Cloning site Green=Tags(s) MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSC FNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVT TSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006007 |
RefSeq Size | 3128 |
RefSeq ORF | 591 |
Synonyms | DFNA66; endolyn; MGC-24; MGC-24v; MUC-24 |
Locus ID | 8763 |
UniProt ID | Q04900 |
Cytogenetics | 6q21 |
Summary | This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sezary syndrome, a type of blood cancer, and a mutation in this gene may be associated with impaired hearing. [provided by RefSeq, Oct 2016] |
Protein Families | Secreted Protein, Transmembrane |
Protein Pathways | Lysosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416885 | CD164 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416885 | Transient overexpression lysate of CD164 molecule, sialomucin (CD164), transcript variant 1 |
USD 396.00 |
|
TP302234 | Recombinant protein of human CD164 molecule, sialomucin (CD164), transcript variant 1 |
USD 439.00 |
{0} Product Review(s)
Be the first one to submit a review