ACP6 (NM_016361) Human Mass Spec Standard

CAT#: PH302269

ACP6 MS Standard C13 and N15-labeled recombinant protein (NP_057445)

Product Images

Coomassie blue staining of purified ACP6 protein (Cat# TP302269). The protein was produced from HEK293T cells transfected with ACP6 cDNA clone (Cat# RC202269) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202269
• Predicted MW: 48.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202269 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MITGVFSMRLWTPVGVLTSLAYCLHQRRVALAELQEADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPL
  EEQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFAGQLTKVGMQQMFALGERLR
  KNYVEDIPFLSPTFNPQEVFIRSTNIFRNLESTRCLLAGLFQCQKEGPIIIHTDEADSEVLYPNYQSCWS
  LRQRTRGRRQTASLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQR
  AVDTSLYILPKEDRESLQMAVGPFLHILESNLLKAMDSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFDH
  KWPPFAVDLTMELYQHLESKEWFVQLYYHGKEQVPRGCPDGLCPLDMFLNAMSVYTLSPEKYHALCSQTQ
  VMEVGNEE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057445
• RefSeq Size: 1832
• RefSeq ORF: 1284
• Synonyms: ACPL1; LPAP; PACPL1
• Locus ID: 51205
• UniProt ID: Q9NPH0
• Cytogenetics: 1q21.2
• Summary: This gene encodes a member of the histidine acid phosphatase protein family. The encoded protein hydrolyzes lysophosphatidic acid, which is involved in G protein-coupled receptor signaling, lipid raft modulation, and in balancing lipid composition within the cell. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2016]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Riboflavin metabolism