DIMT1L (DIMT1) (NM_014473) Human Mass Spec Standard

CAT#: PH302326

DIMT1L MS Standard C13 and N15-labeled recombinant protein (NP_055288)

Product Images

Coomassie blue staining of purified DIMT1 protein (Cat# TP302326). The protein was produced from HEK293T cells transfected with DIMT1 cDNA clone (Cat# RC202326) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202326
• Predicted MW: 35.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202326 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNM
  TVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFK
  LLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIE
  PKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHCSVHNIIIPEDFSIADKIQQIL
  TSTGFSDKRARSMDIDDFIRLLHGFNAEGIHFS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055288
• RefSeq Size: 1557
• RefSeq ORF: 939
• Synonyms: DIM1; DIMT1L; HSA9761; HUSSY5
• Locus ID: 27292
• UniProt ID: Q9UNQ2, A8K9K8
• Cytogenetics: 5q12.1
• Summary: The protein encoded by this gene is a methyltransferase that is responsible for dimethylation of adjacent adenosines near the 18S rRNA decoding site. The encoded protein is essential for ribosome biogenesis, although its catalytic activity is not involved in the process. The yeast ortholog of this protein functions in the cytoplasm while this protein functions in the nucleus. [provided by RefSeq, Jan 2017]
• Protein Families: Druggable Genome