LYRM4 (NM_020408) Human Mass Spec Standard

CAT#: PH302346

LYRM4 MS Standard C13 and N15-labeled recombinant protein (NP_065141)

Product Images

Coomassie blue staining of purified LYRM4 protein (Cat# TP302346). The protein was produced from HEK293T cells transfected with LYRM4 cDNA clone (Cat# RC202346) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202346
• Predicted MW: 10.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202346 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQV
  HIGQLYSTDKLIIENRDMPRT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065141
• RefSeq Size: 1514
• RefSeq ORF: 273
• Synonyms: C6orf149; CGI-203; COXPD19; ISD11
• Locus ID: 57128
• UniProt ID: Q9HD34
• Cytogenetics: 6p25.1
• Summary: The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis. [provided by RefSeq, Sep 2016]