LYRM4 (NM_020408) Human Recombinant Protein

CAT#: TP302346

Recombinant protein of human LYR motif containing 4 (LYRM4)

Product Images

Coomassie blue staining of purified LYRM4 protein (Cat# TP302346). The protein was produced from HEK293T cells transfected with LYRM4 cDNA clone (Cat# RC202346) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202346 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQV
  HIGQLYSTDKLIIENRDMPRT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065141
• Locus ID: 57128
• UniProt ID: Q9HD34
• Cytogenetics: 6p25.1
• Refseq Size: 1514
• Refseq ORF: 273
• Synonyms: C6orf149; CGI-203; COXPD19; ISD11
• Summary: The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis. [provided by RefSeq, Sep 2016]