SNX3 (NM_003795) Human Mass Spec Standard

CAT#: PH302354

SNX3 MS Standard C13 and N15-labeled recombinant protein (NP_003786)

Product Images

Coomassie blue staining of purified SNX3 protein (Cat# TP302354). The protein was produced from HEK293T cells transfected with SNX3 cDNA clone (Cat# RC202354) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202354
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202354 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRR
  YSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERC
  LHMFLQDEIIDKSYTPSKIRHA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003786
• RefSeq Size: 1777
• RefSeq ORF: 486
• Synonyms: Grd19; MCOPS8; SDP3
• Locus ID: 8724
• UniProt ID: O60493
• Cytogenetics: 6q21
• Summary: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like most family members. This protein interacts with phosphatidylinositol-3-phosphate, and is involved in protein trafficking. A pseudogene of this gene is present on the sex chromosomes. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2014]