DPF2 (NM_006268) Human Mass Spec Standard

CAT#: PH302364

DPF2 MS Standard C13 and N15-labeled recombinant protein (NP_006259)

Product Images

Coomassie blue staining of purified DPF2 protein (Cat# TP302364). The protein was produced from HEK293T cells transfected with DPF2 cDNA clone (Cat# RC202364) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202364
• Predicted MW: 44.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202364 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQ
  LYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDD
  DSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYA
  CDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDS
  KINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDR
  GYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006259
• RefSeq Size: 2545
• RefSeq ORF: 1173
• Synonyms: CSS7; REQ; ubi-d4; UBID4
• Locus ID: 5977
• UniProt ID: Q92785, A0A024R582
• Cytogenetics: 11q13.1
• Summary: 'The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transcription Factors