DPF2 (56-155) mouse monoclonal antibody, clone 2F6, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
DPF2 (56-155) mouse monoclonal antibody, clone 2F6, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal REQUIEM Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | REQUIEM antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human Requiem. |
Rabbit polyclonal anti-REQU antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human REQU. |
Rabbit Polyclonal Anti-DPF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DPF2 Antibody: synthetic peptide directed towards the middle region of human DPF2. Synthetic peptide located within the following region: GKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPD |
Rabbit Polyclonal Anti-DPF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DPF2 Antibody: synthetic peptide directed towards the middle region of human DPF2. Synthetic peptide located within the following region: RRGKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHY |
Rabbit Polyclonal Anti-DPF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DPF2 antibody: synthetic peptide directed towards the N terminal of human DPF2. Synthetic peptide located within the following region: MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQ |
Rabbit Polyclonal Anti-DPF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DPF2 antibody: synthetic peptide directed towards the middle region of human DPF2. Synthetic peptide located within the following region: QLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNS |
Rabbit Polyclonal Anti-DPF2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DPF2 |
DPF2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 126-391 of human DPF2 (NP_006259.1). |
Modifications | Unmodified |
DPF2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DPF2. |