DPF2 Rabbit Polyclonal Antibody

CAT#: TA343596

Rabbit Polyclonal Anti-DPF2 Antibody

Product Images

WB Suggested Anti-DPF2 Antibody Titration: 0.3125 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate; DPF2 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DPF2 antibody: synthetic peptide directed towards the N terminal of human DPF2. Synthetic peptide located within the following region: MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: double PHD fingers 2
• Database Link:
  NP_006259
  Entrez Gene 5977 Human
  UniProt ID Q92785
• Background: DPF2 is a member of the d4 domain family, characterized by a zinc finger-like structural motif. DPF2 functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory
• Synonyms: REQ; ubi-d4; UBID4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors