ABHD10 (NM_018394) Human Mass Spec Standard

CAT#: PH302393

ABHD10 MS Standard C13 and N15-labeled recombinant protein (NP_060864)

Product Images

Coomassie blue staining of purified ABHD10 protein (Cat# TP302393). The protein was produced from HEK293T cells transfected with ABHD10 cDNA clone (Cat# RC202393) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202393
• Predicted MW: 33.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202393 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNRPDLPNLAYKK
  LKGKSPGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDD
  LADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSMPSKYS
  EEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDDIVPWHTSMQVADRVLSTDVDVILRKHSDHR
  MREKADIQLLVYTIDDLIDKLSTIVN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060864
• RefSeq Size: 2771
• RefSeq ORF: 918
• Synonyms: FLJ11342
• Locus ID: 55347
• UniProt ID: Q9NUJ1
• Cytogenetics: 3q13.2
• Summary: This gene encodes a mitochondrially-localized enzyme that acts in liver cells as a hydrolase. The encoded protein removes glucuronide from mycophenolic acid acyl-glucuronide. There is a pseudogene for this gene on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]