UCK2 (NM_012474) Human Mass Spec Standard

CAT#: PH302406

UCK2 MS Standard C13 and N15-labeled recombinant protein (NP_036606)

Product Images

Coomassie blue staining of purified UCK2 protein (Cat# TP302406). The protein was produced from HEK293T cells transfected with UCK2 cDNA clone (Cat# RC202406) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202406
• Predicted MW: 29.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202406 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTS
  EQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAF
  YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR
  GADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036606
• RefSeq Size: 4940
• RefSeq ORF: 783
• Synonyms: TSA903; UK; UMPK
• Locus ID: 7371
• UniProt ID: Q9BZX2
• Cytogenetics: 1q24.1
• Summary: 'This gene encodes a pyrimidine ribonucleoside kinase. The encoded protein (EC 2.7.1.48) catalyzes phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively.[provided by RefSeq, Oct 2010]'
• Protein Families: Druggable Genome
• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism