VEGFB (NM_003377) Human Mass Spec Standard
CAT#: PH302426
VEGFB MS Standard C13 and N15-labeled recombinant protein (NP_003368)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202426 |
Predicted MW | 21.6 kDa |
Protein Sequence |
>RC202426 protein sequence
Red=Cloning site Green=Tags(s) MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVP SCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT PHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003368 |
RefSeq Size | 1822 |
RefSeq ORF | 621 |
Synonyms | VEGFL; VRF |
Locus ID | 7423 |
UniProt ID | P49765, Q7LAP4 |
Cytogenetics | 11q13.1 |
Summary | 'This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a ligand for VEGFR-1 (vascular endothelial growth factor receptor 1) and NRP-1 (neuropilin-1). Studies in mice showed that this gene was co-expressed with nuclear-encoded mitochondrial genes and the encoded protein specifically controlled endothelial uptake of fatty acids. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Sep 2011]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Bladder cancer, Cytokine-cytokine receptor interaction, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418732 | VEGFB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418732 | Transient overexpression lysate of vascular endothelial growth factor B (VEGFB) |
USD 396.00 |
|
TP302426 | Recombinant protein of human vascular endothelial growth factor B (VEGFB) |
USD 823.00 |
|
TP723473 | Purified recombinant protein of Human vascular endothelial growth factor B (VEGFB). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review