VEGFB (NM_003377) Human Recombinant Protein
CAT#: TP302426
Recombinant protein of human vascular endothelial growth factor B (VEGFB)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202426 protein sequence
Red=Cloning site Green=Tags(s) MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVP SCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT PHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003368 |
Locus ID | 7423 |
UniProt ID | P49765, Q7LAP4 |
Cytogenetics | 11q13.1 |
Refseq Size | 1822 |
Refseq ORF | 621 |
Synonyms | VEGFL; VRF |
Summary | This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a ligand for VEGFR-1 (vascular endothelial growth factor receptor 1) and NRP-1 (neuropilin-1). Studies in mice showed that this gene was co-expressed with nuclear-encoded mitochondrial genes and the encoded protein specifically controlled endothelial uptake of fatty acids. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Bladder cancer, Cytokine-cytokine receptor interaction, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418732 | VEGFB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418732 | Transient overexpression lysate of vascular endothelial growth factor B (VEGFB) |
USD 396.00 |
|
PH302426 | VEGFB MS Standard C13 and N15-labeled recombinant protein (NP_003368) |
USD 2,055.00 |
|
TP723473 | Purified recombinant protein of Human vascular endothelial growth factor B (VEGFB). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review