GMPR1 (GMPR) (NM_006877) Human Mass Spec Standard

CAT#: PH302453

GMPR MS Standard C13 and N15-labeled recombinant protein (NP_006868)

Product Images

Coomassie blue staining of purified GMPR protein (Cat# TP302453). The protein was produced from HEK293T cells transfected with GMPR cDNA clone (Cat# RC202453) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202453
• Predicted MW: 37.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202453 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH
  SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVE
  FVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAH
  GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAG
  GVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006868
• RefSeq Size: 1515
• RefSeq ORF: 1035
• Synonyms: GMPR 1; GMPR1
• Locus ID: 2766
• UniProt ID: P36959
• Cytogenetics: 6p22.3
• Summary: 'This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of GMP to IMP. The protein also functions in the re-utilization of free intracellular bases and purine nucleosides.[provided by RefSeq, Oct 2009]'
• Protein Families: Druggable Genome
• Protein Pathways: Purine metabolism