Chemokine Receptor D6 (ACKR2) (NM_001296) Human Mass Spec Standard

CAT#: PH302459

CCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001287)

Product Images

Coomassie blue staining of purified ACKR2 protein (Cat# TP302459). The protein was produced from HEK293T cells transfected with ACKR2 cDNA clone (Cat# RC202459) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202459
• Predicted MW: 43.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202459 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLPVFYSLIFVLGLSGNLLLLMV
  LLRYVPRRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSL
  DKYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNCHADFGGHGTIWKLFL
  RFQQNLLGFLLPLLAMIFFYSRIGCVLVRLRPAGQGRALKIAAALVVAFFVLWFPYNLTLFLHTLLDLQV
  FGNCEVSQHLDYALQVTESIAFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSES
  SILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001287
• RefSeq Size: 2978
• RefSeq ORF: 1152
• Synonyms: CCBP2; CCR9; CCR10; CMKBR9; D6; hD6
• Locus ID: 1238
• UniProt ID: O00590, A1LP82
• Cytogenetics: 3p22.1
• Summary: 'This gene encodes a beta chemokine receptor, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptor-mediated signal transduction are critical for the recruitment of effector immune cells to the inflammation site. This gene is expressed in a range of tissues and hemopoietic cells. The expression of this receptor in lymphatic endothelial cells and overexpression in vascular tumors suggested its function in chemokine-driven recirculation of leukocytes and possible chemokine effects on the development and growth of vascular tumors. This receptor appears to bind the majority of beta-chemokine family members; however, its specific function remains unknown. This gene is mapped to chromosome 3p21.3, a region that includes a cluster of chemokine receptor genes. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, GPCR, Transmembrane