Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Mass Spec Standard

CAT#: PH302475

PSAT1 MS Standard C13 and N15-labeled recombinant protein (NP_478059)

Product Images

Coomassie blue staining of purified PSAT1 protein (Cat# TP302475). The protein was produced from HEK293T cells transfected with PSAT1 cDNA clone (Cat# RC202475) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202475
• Predicted MW: 40.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202475 representing NM_058179
  Red=Cloning site Green=Tags(s)
  
  MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNY
  KVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTW
  NLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVV
  IVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYE
  IIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVT
  IEDVQKLAAFMKKFLEMHQL
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_478059
• RefSeq Size: 2221
• RefSeq ORF: 1110
• Synonyms: EPIP; NLS2; PSA; PSAT; PSATD
• Locus ID: 29968
• UniProt ID: Q9Y617, A0A024R222
• Cytogenetics: 9q21.2
• Summary: This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associated with phosphoserine aminotransferase deficiency. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, and 8. [provided by RefSeq, Jul 2013]
• Protein Pathways: Glycine, serine and threonine metabolism, Metabolic pathways, Vitamin B6 metabolism