Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Recombinant Protein

CAT#: TP302475

Recombinant protein of human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1

Product Images

Coomassie blue staining of purified PSAT1 protein (Cat# TP302475). The protein was produced from HEK293T cells transfected with PSAT1 cDNA clone (Cat# RC202475) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC202475
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDN
  YKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPS
  TWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGV
  TVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQ
  TIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASL
  YNAVTIEDVQKLAAFMKKFLEMHQL
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
  Recombinant protein using RC202475 also available, TP302475M
• Tag: C-Myc/DDK
• Predicted MW: 40.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_478059
• Locus ID: 29968
• UniProt ID: Q9Y617, A0A024R222
• Cytogenetics: 9q21.2
• Refseq Size: 2221
• Refseq ORF: 1110
• Synonyms: EPIP; NLS2; PSA; PSAT; PSATD
• Summary: This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associated with phosphoserine aminotransferase deficiency. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, and 8. [provided by RefSeq, Jul 2013]
• Protein Pathways: Glycine, serine and threonine metabolism, Metabolic pathways, Vitamin B6 metabolism